The Canine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP) (Gene ID: 403850). For research use only. Made in the USA

Codice: RP0101D-025 | Marca: Kingfisher | Confezionamento:

Note

CXCL8

Dettagli prodotto
  • Codice: RP0101D-025
  • Marca: Kingfisher
  • Confezionamento: Lyophilized
  • Link: Apri link
  • Stoccaggio: -20 C
  • Tipo di campione: Protein
  • Simbolo target: IL-8