The Canine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-6 Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM) (Gene ID: 403985). For research use only. Made in the USA