The Chicken TNFSF15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken TNFSF15 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA

Codice: RP0116C-500 | Marca: Kingfisher | Confezionamento:

Note

TL1A

Dettagli prodotto
  • Codice: RP0116C-500
  • Marca: Kingfisher
  • Confezionamento: Lyophilized
  • Link: Apri link
  • Stoccaggio: -20 C
  • Tipo di campione: Protein
  • Simbolo target: TNFSF15