The Canine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES) (Gene ID: 403790). For research use only. Made in the USA

Codice: RP0117D-005 | Marca: Kingfisher | Confezionamento: