The Swine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 beta Specifications: (Molecular Weight: 17.6 kDa) (Amino Acid Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)) (Gene ID: 397122). For research use only. Made in the USA

Codice: RP0297S-005 | Marca: Kingfisher | Confezionamento:

Note

IL-1F2

Dettagli prodotto
  • Codice: RP0297S-005
  • Marca: Kingfisher
  • Confezionamento: Lyophilized
  • Link: Apri link
  • Stoccaggio: -20 C
  • Tipo di campione: Protein
  • Simbolo target: IL-1 beta