The Bovine IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-16 Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)) (Gene ID: 506314). For research use only. Made in the USA

Codice: RP0311B-500 | Marca: Kingfisher | Confezionamento: