The Mouse IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)) (Gene ID: 16176). For research use only. Made in the USA