The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)) (Gene ID: 414347). For research use only. Made in the USA

Codice: RP0361B-025 | Marca: Kingfisher | Confezionamento:

Note

MIP-1 beta