The Guinea Pig CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72)) (Gene ID: 100135510). For research use only. Made in the USA

Codice: RP0363GP-025 | Marca: Kingfisher | Confezionamento:

Note

GRO alpha

Dettagli prodotto
  • Codice: RP0363GP-025
  • Marca: Kingfisher
  • Confezionamento: Lyophilized
  • Link: Apri link
  • Stoccaggio: -20 C
  • Tipo di campione: Protein
  • Simbolo target: CXCL1