The Bovine APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Bovine APRIL Specifications: (Molecular Weight: 16.5 kDa) (Amino Acid Sequence: AVLTRKHKKKRSVLHLVPINITSKEDSDVTEVMWQPALQRGRGLEAQGYVVRVWDAGVYLLYSQVLFHDETFTMGQMVSREGQGRQETLFRCIQSMPSNPDWAYNSCYSAGVFHLHQGDILSVVIPRARAKLSLSPHGTFLGLVKL (146)) (Gene ID: 538567). For research use only. Made in the USA