The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)) (Gene ID: 102137164). For research use only. Made in the USA

Codice: RP1877Y-005 | Marca: Kingfisher | Confezionamento: