Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.
A synthesized peptide derived from human ALDOC, corresponding to a region within C-terminal amino acids.
Aldo-keto reductase (AKRS) is distributed in prokaryotes and eukaryotes, and there are a variety of isoforms. AKRS can catalyze the NADPH-dependent carbonyl reduction reaction to generate the corresponding alcohols. Studies have shown that AKRS are associated with a variety of cancers. The principle of this kit is that the substrate is catalyzed by AKRS, and the chromogenic substance produced by the reaction of the product and the chromogenic agent has a characteristic absorption peak at 450 nm. By detecting the amount of chromogenic substance produced per unit time, the activity of AKRS enzyme in the sample can be calculated.
Aldosterone ELISA Assay Kit
C164H278N58O45S4
ALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY(Disulfidebridge:C13-C29)
Inserisci la tua e-mail e seleziona le aree di interesse per ricevere le ultime novità, approfondimenti e promozioni.
Seleziona uno o più ambiti di interesse per ricevere comunicazioni più utili e mirate.
2025 TEMA Ricerca - All Rights Reserved.
