The Bovine CCL21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL21 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL21 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL21 Specifications: (Molecular Weight: 12.0 kDa) (Amino Acid Sequence: SDGGAQDCCL RYSRKKIPAN IVRSYRKQDP TLSCAMPAIL FSPRKRSQPE LCADPKEAWV QKLMQRLDKP SAPRKPVQDC KKEKGAPKSG KKGKGSKGCK RTEISKGP). For research use only. Made in the USA.
The Bovine CCL26 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL26 applications are for cell culture, ELISA Standard, ELISpot Control, and Western Blot Control. Bovine CCL26 Specifications: (Molecular Weight:8.4 kDa) (Amino Acid Sequence:TRGSDVAKFC CFQYSQKTLP WKQVHSYEFT RNICSLKAVI FTTKRGRKVC AQPKEEWVQR HISKLRAQQQ L ). For research use only. Made in the USA.
The Bovine CCL2 (MCP-1) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL2 (MCP-1) Biotinylated applications are for cell culture. Bovine CCL2 (MCP-1) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL2 (MCP-1) Biotinylated Specifications: (Molecular Weight: 8.8 kDa) (Amino Acid Sequence: QPDAINSQVA CCYTFNSKKI SMQRLMNYRR VTSSKCPKEA VIFKTILGKE LCADPKQKWV QDSINYLNKK NQTPKP) (Gene ID: 281043). For research use only. Made in the USA
The Bovine CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL2 Specifications: (Molecular Weight: 8.8 kDa) (Amino Acid Sequence: QPDAINSQVA CCYTFNSKKI SMQRLMNYRR VTSSKCPKEA VIFKTILGKE LCADPKQKWV QDSINYLNKK NQTPKP) (Gene ID: 281043). For research use only. Made in the USA
The Bovine CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APFGADTPTA CCFSYVARQL SRKIVADYFE TSSQCSKPGV IFQTKKGRQV CANPTEDWVQ EYITDLELNA (70)) (Gene ID: 282170). For research use only. Made in the USA
The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)) (Gene ID: 414347). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
