The Feline IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-13 Specifications: (Molecular Weight: 12.7 kDa) (Amino Acid Sequence: SPGPHSRREL KELIEELVNI TQNQVSLCNG SMVWSVNLTT GMQYCAALES LINVSDCTAI QRTQRMLKAL CTQKPSAGQT ASERSRDTKI EVIQLVKNLL NHLRRNFRHG NFK (113)) (Gene ID: 101084678). For research use only. Made in the USA
The Feline IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-17A Specifications: (Molecular Weight: 15.1 kDa) (Amino Acid Sequence: GIAFPQNPGC PTTEDKNFPQ HVKVNVNILN GNKSSRRPLD YYRRSTSPWS LHRNEDPERY PSVIWEAKCL HWGCVNTEGK EDHHMNSVPI QQEILVLRRE SRHCPHSFRL EKMLVTVGCT CVTPIVRHVV (130)) (Gene ID: 101095339). For research use only. Made in the USA
The Feline IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-18 Specifications: (Molecular Weight: 18.2 kDa) (Amino Acid Sequence: YFGKLEHKLS ILRNLNDQVL FINQGDQPVF EDMPDSDCTD NAPRTEFIIY MYKDSLTRGL AVTISVNYKT MSTLSCENKI ISFKEMSPPE SINDEGNDII FFQRSVPGHD DKIQFESSLY KGYFLACEKE KDLFKLILKK KDENGDKSIM FTVQNKN (157)) (Gene ID: 493688). For research use only. Made in the USA
The Feline IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 alpha Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence: SVAPNFYSSEKYNYQKIIKSQFILNDNLSQSVIRKAGGKYLAAAALQNLDDAVKFDMGAYTSKEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFKSVAHPKLFIATQEEQLVHMARGLPSVTDFQILETQS (158)) (Gene ID: 493944). For research use only. Made in the USA
The Feline IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS) (Gene ID: 768274). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
