Recombinant Proteins

Descrizione Azione

The Feline IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS) (Gene ID: 768274). For research use only. Made in the USA

Codice: RP0098F-025
Dettagli

The Feline IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS) (Gene ID: 768274). For research use only. Made in the USA

Codice: RP0098F-005
Dettagli

The Feline IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS) (Gene ID: 768274). For research use only. Made in the USA

Codice: RP0098F-500
Dettagli

The Feline IL-25 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-25 applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-25 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-25 Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: IRIKKDCIHW SSCCPSKGQN PTHEWLTENT VLMTPPESAS LIHSLESCRA SEDGPLNSRS ISPWRYELDR DLNRLPQDLY HARCLCPHCV SLQTGSHMDP LGNSELLYHN QTVFYRRPCP GEQGTRDGYC LEQRLYRVSL ACVCVRPRVM A (151)) (Gene ID: 101095746). For research use only. Made in the USA

Codice: RP1706F-025
Dettagli

The Feline IL-25 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-25 applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-25 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-25 Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: IRIKKDCIHW SSCCPSKGQN PTHEWLTENT VLMTPPESAS LIHSLESCRA SEDGPLNSRS ISPWRYELDR DLNRLPQDLY HARCLCPHCV SLQTGSHMDP LGNSELLYHN QTVFYRRPCP GEQGTRDGYC LEQRLYRVSL ACVCVRPRVM A (151)) (Gene ID: 101095746). For research use only. Made in the USA

Codice: RP1706F-005
Dettagli

The Feline IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-2 Specifications: (Molecular Weight: 15.4 kDa) (Amino Acid Sequence: APASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRMLTFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGSETRFTCNYDDETATIVEFLNKWITFCQSIFSTLT) (Gene ID: 751114). For research use only. Made in the USA

Codice: RP0099F-025
Dettagli

The Feline IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-2 Specifications: (Molecular Weight: 15.4 kDa) (Amino Acid Sequence: APASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRMLTFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGSETRFTCNYDDETATIVEFLNKWITFCQSIFSTLT) (Gene ID: 751114). For research use only. Made in the USA

Codice: RP0099F-005
Dettagli

The Feline IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-36 Receptor Antagonist Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). For research use only. Made in the USA

Codice: RP1989F-005
Dettagli

The Feline IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-36 Receptor Antagonist Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). For research use only. Made in the USA

Codice: RP1989F-025
Dettagli

The Feline IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-36 Receptor Antagonist Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). For research use only. Made in the USA

Codice: RP1989F-500
Dettagli

The Feline IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-36 Receptor Antagonist Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). For research use only. Made in the USA

Codice: RP1989F-100
Dettagli

The Feline IL-4 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-4 Biotinylated applications are for cell culture. Feline IL-4 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-4 Biotinylated Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: QNFNNTLKEI IKTLNILTAR NDSCMELTVM DVLAAPKNTS DKEIFCRATT VLRQIYTHHN CSTKFLKGLD RNLSSMANRT CSVNEVKKCT LKDFLERLKA IMQKKYSKH (109)) (Gene ID: 751514). For research use only. Made in the USA

Codice: RPB1881F-010
Dettagli