Recombinant Proteins

Descrizione Azione

The Feline PD-L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline PD-L1 applications are for cell culture, ELISA standard, and Western Blot Control. Feline PD-L1 yeast-derived recombinant protein can be purchased in multiple sizes. Feline PD-L1 Specifications: (Molecular Weight: 24.6 kDa) (Amino Acid Sequence: FTITVSKDLY VVEYGSNVTM ECRFPVEEQL DLVSLIVYWE MEDKKIIQFV QGKEDLKVQH RSYSQRAQLL KDQLFLGKAA LQITNVTLED AGVYCCLIGY GGADYKRITL KVHAPYRKIN QRISVDPVTS EHELMCQAEG YPTAEVIWTN SAHQVLNGKT IISVSNMETK LFNVTSTLRI NTTANEIFYC TFLQRSSPEG NSTAELVIPE PFLVPANER (219)) (Gene ID: 100127110 (feline)). For research use only. Made in the USA

Codice: RP2204F-500
Dettagli

The Feline PD-L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline PD-L1 applications are for cell culture, ELISA standard, and Western Blot Control. Feline PD-L1 yeast-derived recombinant protein can be purchased in multiple sizes. Feline PD-L1 Specifications: (Molecular Weight: 24.6 kDa) (Amino Acid Sequence: FTITVSKDLY VVEYGSNVTM ECRFPVEEQL DLVSLIVYWE MEDKKIIQFV QGKEDLKVQH RSYSQRAQLL KDQLFLGKAA LQITNVTLED AGVYCCLIGY GGADYKRITL KVHAPYRKIN QRISVDPVTS EHELMCQAEG YPTAEVIWTN SAHQVLNGKT IISVSNMETK LFNVTSTLRI NTTANEIFYC TFLQRSSPEG NSTAELVIPE PFLVPANER (219)) (Gene ID: 100127110 (feline)). For research use only. Made in the USA

Codice: RP2204F-005
Dettagli

The Feline PD-L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline PD-L1 applications are for cell culture, ELISA standard, and Western Blot Control. Feline PD-L1 yeast-derived recombinant protein can be purchased in multiple sizes. Feline PD-L1 Specifications: (Molecular Weight: 24.6 kDa) (Amino Acid Sequence: FTITVSKDLY VVEYGSNVTM ECRFPVEEQL DLVSLIVYWE MEDKKIIQFV QGKEDLKVQH RSYSQRAQLL KDQLFLGKAA LQITNVTLED AGVYCCLIGY GGADYKRITL KVHAPYRKIN QRISVDPVTS EHELMCQAEG YPTAEVIWTN SAHQVLNGKT IISVSNMETK LFNVTSTLRI NTTANEIFYC TFLQRSSPEG NSTAELVIPE PFLVPANER (219)) (Gene ID: 100127110 (feline)). For research use only. Made in the USA

Codice: RP2204F-025
Dettagli

The Feline PD-L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline PD-L1 applications are for cell culture, ELISA standard, and Western Blot Control. Feline PD-L1 yeast-derived recombinant protein can be purchased in multiple sizes. Feline PD-L1 Specifications: (Molecular Weight: 24.6 kDa) (Amino Acid Sequence: FTITVSKDLY VVEYGSNVTM ECRFPVEEQL DLVSLIVYWE MEDKKIIQFV QGKEDLKVQH RSYSQRAQLL KDQLFLGKAA LQITNVTLED AGVYCCLIGY GGADYKRITL KVHAPYRKIN QRISVDPVTS EHELMCQAEG YPTAEVIWTN SAHQVLNGKT IISVSNMETK LFNVTSTLRI NTTANEIFYC TFLQRSSPEG NSTAELVIPE PFLVPANER (219)) (Gene ID: 100127110 (feline)). For research use only. Made in the USA

Codice: RP2204F-100
Dettagli

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: GLCRNRVTDD VKDVTKLVAN LPKDYKIALK YVPGMDVLPS HCWISVMVEQ LSVSLTDLLD KFSNISEGLS NYSIIDKLVK IVDDLVECVE GHSSENVKKS SKSPEPRLFT PEEFFRIFNR SIDAFKDLEM VASKTSECVV SSTLSPEKDS RVSVTKPFML PPVAA (165)) (Gene ID: 493937). For research use only. Made in the USA

Codice: RP1302F-025
Dettagli

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: GLCRNRVTDD VKDVTKLVAN LPKDYKIALK YVPGMDVLPS HCWISVMVEQ LSVSLTDLLD KFSNISEGLS NYSIIDKLVK IVDDLVECVE GHSSENVKKS SKSPEPRLFT PEEFFRIFNR SIDAFKDLEM VASKTSECVV SSTLSPEKDS RVSVTKPFML PPVAA (165)) (Gene ID: 493937). For research use only. Made in the USA

Codice: RP1302F-500
Dettagli

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: GLCRNRVTDD VKDVTKLVAN LPKDYKIALK YVPGMDVLPS HCWISVMVEQ LSVSLTDLLD KFSNISEGLS NYSIIDKLVK IVDDLVECVE GHSSENVKKS SKSPEPRLFT PEEFFRIFNR SIDAFKDLEM VASKTSECVV SSTLSPEKDS RVSVTKPFML PPVAA (165)) (Gene ID: 493937). For research use only. Made in the USA

Codice: RP1302F-005
Dettagli

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: GLCRNRVTDD VKDVTKLVAN LPKDYKIALK YVPGMDVLPS HCWISVMVEQ LSVSLTDLLD KFSNISEGLS NYSIIDKLVK IVDDLVECVE GHSSENVKKS SKSPEPRLFT PEEFFRIFNR SIDAFKDLEM VASKTSECVV SSTLSPEKDS RVSVTKPFML PPVAA (165)) (Gene ID: 493937). For research use only. Made in the USA

Codice: RP1302F-100
Dettagli

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 493937). For research use only. Made in the USA

Codice: RP0150F-025
Dettagli

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 493937). For research use only. Made in the USA

Codice: RP0150F-100
Dettagli

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 493937). For research use only. Made in the USA

Codice: RP0150F-500
Dettagli

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 493937). For research use only. Made in the USA

Codice: RP0150F-005
Dettagli