Recombinant Proteins

Descrizione Azione

The Ferret CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. Ferret CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Ferret CXCL9 Specifications: (Molecular Weight: 12.2 kDa) (Amino Acid Sequence: TPTMRNRRCS CITTTQGTIQ SKFLKDLKQF APSSYCEKTE IIATMKNGYQ MCLNPDLAVV QELIKEWEKQ VNQKKKQKKG KRYQKSKKAL KVKKSQHPRQ KKTT (104)) (Gene ID: 101692482). For research use only. Made in the USA

Codice: RP1779FT-500
Dettagli

The Ferret IFN alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN alpha applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN alpha yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN alpha Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: CDLPQDHGLL NWRALMLLRQ MRRVSTFSCL RDRNDFAFPQ EVFDGKPLQK AQAISVLHVT NQKTFHLFCT EASPAPWNTT LLEQLCSGLS EQMSHLAACP LQEAGVGETP LVNGDSILRN YFQRISLYLQ EKQYSHCAWE MVRAEIMKVF SSSTTLQERL RGKKQDLVQH GDDSH (175)) (Gene ID: 101686116). For research use only. Made in the USA

Codice: RP1774FT-500
Dettagli

The Ferret IFN alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN alpha applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN alpha yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN alpha Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: CDLPQDHGLL NWRALMLLRQ MRRVSTFSCL RDRNDFAFPQ EVFDGKPLQK AQAISVLHVT NQKTFHLFCT EASPAPWNTT LLEQLCSGLS EQMSHLAACP LQEAGVGETP LVNGDSILRN YFQRISLYLQ EKQYSHCAWE MVRAEIMKVF SSSTTLQERL RGKKQDLVQH GDDSH (175)) (Gene ID: 101686116). For research use only. Made in the USA

Codice: RP1774FT-005
Dettagli

The Ferret IFN alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN alpha applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN alpha yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN alpha Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: CDLPQDHGLL NWRALMLLRQ MRRVSTFSCL RDRNDFAFPQ EVFDGKPLQK AQAISVLHVT NQKTFHLFCT EASPAPWNTT LLEQLCSGLS EQMSHLAACP LQEAGVGETP LVNGDSILRN YFQRISLYLQ EKQYSHCAWE MVRAEIMKVF SSSTTLQERL RGKKQDLVQH GDDSH (175)) (Gene ID: 101686116). For research use only. Made in the USA

Codice: RP1774FT-100
Dettagli

The Ferret IFN alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN alpha applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN alpha yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN alpha Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: CDLPQDHGLL NWRALMLLRQ MRRVSTFSCL RDRNDFAFPQ EVFDGKPLQK AQAISVLHVT NQKTFHLFCT EASPAPWNTT LLEQLCSGLS EQMSHLAACP LQEAGVGETP LVNGDSILRN YFQRISLYLQ EKQYSHCAWE MVRAEIMKVF SSSTTLQERL RGKKQDLVQH GDDSH (175)) (Gene ID: 101686116). For research use only. Made in the USA

Codice: RP1774FT-025
Dettagli

The Ferret IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN beta Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166)) (Gene ID: 101679100). For research use only. Made in the USA

Codice: RP1822FT-025
Dettagli

The Ferret IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN beta Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166)) (Gene ID: 101679100). For research use only. Made in the USA

Codice: RP1822FT-005
Dettagli

The Ferret IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN gamma Specifications: (Molecular Weight: 18.7 kDa) (Amino Acid Sequence: CDLPQDHGLL HWRALMLLQQ MRRLSASSCD KYTNDFGFPQ EVFDGKQLQK AQALSVIHVT NQKTFHLFCT EASPAPWNTT LLEQLCSGLS EQLGHLAACP LQEAGVGELP LVNGDSILRN YFQRISLYLQ EKQYSPCAWE MVRAEIMKPL YASTVLHKRL RSRK (164)) (Gene ID: 101693741). For research use only. Made in the USA

Codice: RP1187FT-025
Dettagli

The Ferret IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN gamma Specifications: (Molecular Weight: 18.7 kDa) (Amino Acid Sequence: CDLPQDHGLL HWRALMLLQQ MRRLSASSCD KYTNDFGFPQ EVFDGKQLQK AQALSVIHVT NQKTFHLFCT EASPAPWNTT LLEQLCSGLS EQLGHLAACP LQEAGVGELP LVNGDSILRN YFQRISLYLQ EKQYSPCAWE MVRAEIMKPL YASTVLHKRL RSRK (164)) (Gene ID: 101693741). For research use only. Made in the USA

Codice: RP1187FT-100
Dettagli

The Ferret IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN gamma Specifications: (Molecular Weight: 18.7 kDa) (Amino Acid Sequence: CDLPQDHGLL HWRALMLLQQ MRRLSASSCD KYTNDFGFPQ EVFDGKQLQK AQALSVIHVT NQKTFHLFCT EASPAPWNTT LLEQLCSGLS EQLGHLAACP LQEAGVGELP LVNGDSILRN YFQRISLYLQ EKQYSPCAWE MVRAEIMKPL YASTVLHKRL RSRK (164)) (Gene ID: 101693741). For research use only. Made in the USA

Codice: RP1187FT-005
Dettagli

The Ferret IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN gamma Specifications: (Molecular Weight: 18.7 kDa) (Amino Acid Sequence: CDLPQDHGLL HWRALMLLQQ MRRLSASSCD KYTNDFGFPQ EVFDGKQLQK AQALSVIHVT NQKTFHLFCT EASPAPWNTT LLEQLCSGLS EQLGHLAACP LQEAGVGELP LVNGDSILRN YFQRISLYLQ EKQYSPCAWE MVRAEIMKPL YASTVLHKRL RSRK (164)) (Gene ID: 101693741). For research use only. Made in the USA

Codice: RP1187FT-500
Dettagli

The Ferret IFN lambda 3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN lambda 3 applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN lambda 3 yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN lambda 3 Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: VPGPKPLKVF PDAGGCHLAQ FQSLSPQELQ AFKKAKDTFE ESLSLKAWSC RPRLFPRTWD LQQLQVGERP VALEAEVALT LKVLETMADR SLGSILDQPL HTLRHIQSEL QACVEAQPLA GPRPRGRLHH WLHRLHEAPK KEPLGCLENS VMFNLFRLLT RDLKCVASGD LCA (173)) (Gene ID: 101672127). For research use only. Made in the USA

Codice: RP1820FT-100
Dettagli