The Ferret TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. Ferret TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Ferret TNF alpha Specifications: (Molecular Weight: 14.6 kDa) (Amino Acid Sequence: LQWLSRRANA LLANGVELTD NQLIVPSDGL YLIYSQVLFK GRGCSSTNVL LTHTISRFAV SYRTKVNLLS AIKSPCQRET PEGTEAKPWY EPIHLGGVFQ LEKGDRLSAE INLPAYLDFA ESGQVYFGII AL (132)) (Gene ID: 101687148). For research use only. Made in the USA
The Ferret TNFSF15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret TNFSF15 applications are for cell culture, ELISA standard, and Western Blot Control. The Ferret TNFSF15 yeast-derived recombinant protein can be purchased in multiple sizes. Ferret TNFSF15 Specifications: (Molecular Weight: 20.1 kDa) (Amino Acid Sequence: SKGLEFGSSH QRAYASTGAG GDKPRAHLTV VRQSPTQSSK NQFPALHWEH ELGLAFTKNR MNYTNKFLVI PESGDYFVYS QVTFRGTKSE CGEIRQGSRP NKPDSIIVVI TKVTDSYPEP TQLLMGTKSV CEVGSNWFQP IYLGAMFSLQ EGDKLMVNVS DISLVDYTKE DKTFFGAFLL). For research use only. Made in the USA
The FNDC5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. FNDC5 applications are for cell culture, ELISA standard, and Western Blot Control. FNDC5 yeast-derived recombinant protein can be purchased in multiple sizes. FNDC5 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: DSPSAPVNVT VRHLKANSAV VSWDVLEDEV VIGFAISQQK KDVRMLRFIQ EVNTTTRSCA LWDLEEDTEY IVHVQAISIQ GQSPASEPVL FKTPREAEKM ASKNKDEVTM KE (112)) (Gene ID: n/a). For research use only. Made in the USA
The Gibbon IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Gibbon IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Gibbon IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Gibbon IFN beta Specifications: (Molecular Weight: 20.1 kDa) (Amino Acid Sequence: MSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166)) (Gene ID: 100598986). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
