The Bovine CD27 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CD27 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CD27 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CD27 Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: TPGPKSCPEK HYWAQGGWCC QMCEPGTFLV KDCEQHREAA QCNPCTPGVS FMPDHHSRPH CESCRHCNSG LLIRNCTLTA NSECACPEGQ QCRDKDCMEC DGPAQAPGPH PQPSHLPYAE EIAESRTDRH TQTLANSRWL PAPTLSTHWS PQRSLCSANC (170)) (Gene ID: 512514). For research use only. Made in the USA
The Bovine CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CD40 Ligand Specifications: (Molecular Weight: 16.1 kDa) (Amino Acid Sequence: MHKGDQEPQI AAHVISEASS KTTSVLQWAP KGYYTLSNNL VTLENGKQLA VKRQGFYYIY TQVTFCSNRE TLSQAPFIAS LCLKSPSGSE RILLRAANTH SSSKPCGQQS IHLGGVFELQ SGASVFVNVT DPSQVSHGTG FTSFGLLKL (149)) (Gene ID: 282387). For research use only. Made in the USA
The Bovine sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine sCTLA-4 Specifications: (Molecular Weight: 13.8 kDa) (Amino Acid Sequence: FSKGMNVTQP PVVLASSRGV ASFSCEYESS GKADEVRVTV LREAGSQVTE VCAGTYMVED ELTFLDDSTC IGTSRGNKVN LTIQGLRAMD TGLYVCKVEL MYPPPYYVGI GNGTQIYVID PEPCPDSD (128)) (Gene ID: 281732). For research use only. Made in the USA
The Bovine CX3CL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CX3CL1 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CX3CL1 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CX3CL1 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QQHGVNKCNL FCNKMTQKIP ESRLVGYQRN RESCNDGAVI LKTVKGKSFC ADPKEEWVQK AMKHLDHKAS VSQKSG (76)) (Gene ID: 517354). For research use only. Made in the USA
The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.