The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107). For research use only. Made in the USA
The Bovine CXCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL11 Specifications: (Molecular Weight: 8.8 kDa) (Amino Acid Sequence: FPMFKGGRCL CIGPGVKAVK VADIEKVSII YPTNNCDKTE VIITLKTHKG QRCLNPKAKQ AKAIIKKVQR KNSEKYKNI) (Gene ID: 516104). For research use only. Made in the USA
The Bovine CXCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CXCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL13 Specifications: (Molecular Weight: 9.9 kDa) (Amino Acid Sequence: VLETNNTNLK CKCIRKTVSF FPVNLIERLN IIPRGRGCPN TEIIVWMKNK LVICLNPQAK WTQTLIKVLS KRILSTSPAP VVKKRSD (87)) (Gene ID: 511674). For research use only. Made in the USA
The Bovine CXCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CXCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL17 Specifications: (Molecular Weight: 11.2 kDa) (Amino Acid Sequence: SSHTGVARGQ RDQRQASGRW LREGGQECEC QDWFLRAPRR TLMAAPRLTK PCPCDHFKGR MKKTRHQRHH RKSNKPSRAC QQFLTRCLLE SFALPL (96)) (Gene ID: 788717). For research use only. Made in the USA
The Bovine CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL1 Specifications: (Molecular Weight: 8.0 kDa) (Amino Acid Sequence: GAPVVNELRC QCLQTLQGIH LKNIQSVKVT TPGPHCDQTE VIASLKTGQE VCLNPTAPMV KKIIDKMLNK ASAN (74)) (Gene ID: 281212). For research use only. Made in the USA
The Bovine CXCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL4 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CXCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL4 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: QESSFPATFV PLPADSEGGE SEDLQCVCLK TTSGINPRHI SSLEVIGAGL HCPSPQLIAT LKTGRKICLD QQNPLYKKII KRLLKS (86)) (Gene ID: 507790). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
