The Human IL-11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-11 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-11 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-11 Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: RVSPDPRAEL DSTVLLTRSL LADTRQLAAQ LRDKFPADGD HNLDSLPTLA MSAGALGALQ LPGVLTRLRA DLLSYLRHVQ WLRRAGGSSL KTLEPELGTL QARLDRLLRR LQLLMSRLAL PQPPPDPPAP PLAPPSSAWG GIRAAHAILG GLHLTLDWAV RGLLLLKTRL (170)) (Gene ID: 3589). For research use only. Made in the USA
The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)) (Gene ID: 3596). For research use only. Made in the USA
The Human IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Human IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-17A Specifications: (Molecular Weight: 15.1 kDa) (Amino Acid Sequence: GITIPRNPGC PNSEDKNFPR TVMVNLNIHN RNTNTNPKRS SDYYNRSTSP WNLHRNEDPE RYPSVIWEAK CRHLGCINAD GNVDYHMNSV PIQQEILVLR REPPHCPNSF RLEKILVSVG CTCVTPIVHH VA (132)) (Gene ID: 3605). For research use only. Made in the USA
The Human IL-17F yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-17F applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-17F yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-17F Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: ARKIPKVGHT FFQKPESCPP VPGGSMKLDI GIINENQRVS MSRNIESRST SPWNYTVTWD PNRYPSEVVQ AQCRNLGCIN AQGKEDISMN SVPIQQETLV VRRKHQGCSV SFQLEKVLVT VGCTCVTPVI HHVQ (134)) (Gene ID: 112744). For research use only. Made in the USA
The Human IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-18 Specifications: (Molecular Weight: 18.2 kDa) (Amino Acid Sequence: YFGKLESKLS VIRNLNDQVL FIDQGNRPLF EDMTDSDCRD NAPRTIFIIS MYKDSQPRGM AVTISVKCEK ISTLSCENKI ISFKEMNPPD NIKDTKSDII FFQRSVPGHD NKMQFESSSY EGYFLACEKE RDLFKLILKK EDELGDRSIM FTVQNED (157)) (Gene ID: 3606). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
