The Mouse APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Mouse APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 69583). For research use only. Made in the USA
The Mouse B7-H2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse B7-H2 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse B7-H2 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse B7-H2 Specifications: (Molecular Weight: 31.0 kDa) (Amino Acid Sequence: ETEVGAMVGS NVVLSCIDPH RRHFNLSGLY VYWQIENPEV SVTYYLPYKS PGINVDSSYK NRGHLSLDSM KQGNFSLYLK NVTPQDTQEF TCRVFMNTAT ELVKILEEVV RLRVAANFST PVISTSDSSN PGQERTYTCM SKNGYPEPNL YWINTTDNSL IDTALQNNTV YLNKLGLYDV ISTLRLPWTS HGDVLCCVEN VALHQNITSI SQAESFTGNN TKNPQETHNN ELKVLVPVLA VLAAAAFVSF IIYRRTRPHR SYTGPKTVQL ELTDHA (276)) (Gene ID: 50723). For research use only. Made in the USA
The Mouse BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse BAFF applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Mouse BAFF Specifications: (Molecular Weight: 20.6 kDa) (Amino Acid Sequence: AFQGPEETEQ DVDLSAPPAP CLPGCRHSQH DDNGMNLRNI IQDCLQLIAD SDTPTIRKGT YTFVPWLLSF KRGNALEEKE NKIVVRQTGY FFIYSQVLYT DPIFAMGHVI QRKKVHVFGD ELSLVTLFRC IQNMPKTLPN NSCYSAGIAR LEEGDEIQLA IPRENAQISR NGDDTFFGAL KLL (183)) (Gene ID: 24099). For research use only. Made in the USA
The Mouse CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. Mouse CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse CCL11 Specifications: (Molecular Weight: 8.4 kDa) (Amino Acid Sequence: HPGSIPTSCC FIMTSKKIPN TLLKSYKRIT NNRCTLKAIV FKTRLGKEIC ADPKKKWVQD ATKHLDQKLQ TPKP (74)) (Gene ID: 20292). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.