The Mouse IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. Mouse IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IGF-2 Specifications: (Molecular Weight: 7.4 kDa) (Amino Acid Sequence: AYGPGETLCG GELVDTLQFV CSDRGFYFSR PSSRANRRSR GIVEECCFRS CDLALLETYC ATPAKSE (67)) (Gene ID: 17002). For research use only. Made in the USA
The Mouse IL-10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-10 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-10 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-10 Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (170)) (Gene ID: 16153). For research use only. Made in the USA
The Mouse IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-13 Specifications: (Molecular Weight: 12.2 kDa) (Amino Acid Sequence: GPVPRSVSLP LTLKELIEEL SNITQDQTPL CNGSMVWSVD LAAGGFCVAL DSLTNISNCN AIYRTQRILH GLCNRKAPTT VSSLPDTKIE VAHFITKLLS YTKQLFRHGP F (111)) (Gene ID: 16163). For research use only. Made in the USA
The Mouse IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. Mouse IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-16 Specifications: (Molecular Weight: 13.0 kDa) (Amino Acid Sequence: DLNSSTDSAA SASAASDISV ESKEATVCTV TLEKTSAGLG FSLEGGKGSL HGDKPLTINR IFKGTEQGEM VQPGDEILQL AGTAVQGLTR FEAWNVIKAL PDGPVTIVIR RTSLQCKQTT ASADS (125)) (Gene ID: 16170). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
