The Mouse SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse SCF applications are for cell culture, ELISA standard, and Western Blot Control. Mouse SCF yeast-derived recombinant protein can be purchased in multiple sizes. Mouse SCF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: KEICGNPVTD NVKDITKLVA NLPNDYMITL NYVAGMDVLP SHCWLRDMVI QLSLSLTTLL DKFSNISEGL SNYSIIDKLG KIVDDLVLCM EENAPKNIKE SPKRPETRSF TPEEFFSIFN RSIDAFKDFM VASDTSDCVL SSTLGPEKDS RVSVTKPFML PPVAA (165)) (Gene ID: 17311). For research use only. Made in the USA
The Mouse Thrombopoietin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse Thrombopoietin applications are for cell culture, ELISA standard, and Western Blot Control. Mouse Thrombopoietin yeast-derived recombinant protein can be purchased in multiple sizes. Mouse Thrombopoietin Specifications: (Molecular Weight: 12.5 kDa) (Amino Acid Sequence: SPVAPACDPR LLNKLLRDSH LLHSRLSQCP DVDPLSIPVL LPAVDFSLGE WKTQTEQSKA QDILGAVSLL LEGVMAARGQ LEPSCLSSLL GQLSGQVRLL LGALQGLLGT QLPLQGRTTA HKDPNALFLS LQQLLRGKVR FLLLVEGPTL CVRRTLPTTA VPSSTSQLLT LNKFPNRTSG LLETNFSVTA RTAGPGLLSR LQGFRVKITP GQLNQTSRSP VQISGYLNRT HGPVNGTHGL FAGTSLQTLE ASDISPGAFN KGSLAFNLQG GLPPSPSLAP DGHTPFPPSP ALPTTHGSPP QLHPLFPDPS TTMPNSTAPH PVTMYPHPRN LSQET (335)) (Gene ID: 21832). For research use only. Made in the USA
The Mouse TIM-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse TIM-3 applications are for cell culture, ELISA standard, and Western Blot Control. Mouse TIM-3 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse TIM-3 Specifications: (Molecular Weight: 19.3 kDa) (Amino Acid Sequence: RSLENAYVFE VGKNAYLPCS YTLSTPGALV PMCWGKGFCP WSQCTNELLR TDERNVTYQK SSRYQLKGDL NKGDVSLIIK NVTLDDHGTY CCRIQFPGLM NDKKLELKLD IKAAKVTPAQ TAHGDSTTAS PRTLTTERNG SETQTLVTLH NNNGTKISTW ADEIKDSGET IRTA (174)) (Gene ID: 171285). For research use only. Made in the USA
The Mouse TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Mouse TNF alpha Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)) (Gene ID: 21926). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
