The Mouse TNFSF11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse TNFSF11 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse TNFSF11 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse TNFSF11 Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: FSGAPAMMEG SWLDVAQRGK PEAQPFAHLT INAASIPSGS HKVTLSSWYH DRGWAKISNM TLSNGKLRVN QDGFYYLYAN ICFRHHETSG SVPTDYLQLM VYVVKTSIKI PSSHNLMKGG STKNWSGNSE FHFYSINVGG FFKLRAGEEI SIQVSNPSLL DPDQDATYFG AFKVQDID (178)) (Gene ID: 21943). For research use only. Made in the USA
The Mouse TWEAK yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse TWEAK applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse TWEAK yeast-derived recombinant protein can be purchased in multiple sizes. Mouse TWEAK Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: SAPKGRKARP RRAIAAHYEV HPRPGQDGAQ AGVDGTVSGW EETKINSSSP LRYDRQIGEF TVIRAGLYYL YCQVHFDEGK AVYLKLDLLV NGVLALRCLE EFSATAASSP GPQLRLCQVS GLLPLRPGSS LRIRTLPWAH LKAAPFLTYF GLFQVH (156)) (Gene ID: 21944). For research use only. Made in the USA
The Mouse VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Mouse VEGF-A Specifications: (Molecular Weight: 19.3 kDa) (Amino Acid Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)) (Gene ID: 22339). For research use only. Made in the USA
The Mouse/Rat/Hamster VEGF-C yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse/Rat/Hamster VEGF-C applications are for cell culture, ELISA standard, and Western Blot Control. Mouse/Rat/Hamster VEGF-C yeast-derived recombinant protein can be purchased in multiple sizes. Mouse/Rat/Hamster VEGF-C Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: AAHYNTEILK SIDNEWRKTQ CMPREVCIDV GKEFGAATNT FFKPPCVSVY RCGGCCNSEG LQCMNTSTGY LSKTLFEITV PLSQGPKPVT ISFANHTSCR CMSKLDVYRQ VHSIIRR (117)) (Gene ID: 22341). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
