The Ovine IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. Ovine IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine IL-4 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: HKCDITLEEI IKTLNILTSR KNSCMELPVA DVFAAPKNAT EKETFCRAGI ELRRIYRSHM CLNKFLGGLD RNLSSLASKT CSVNEAKTST STLRDLLERL KTIMKEKYSK C (111)) (Gene ID: 443327). For research use only. Made in the USA
The Ovine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Ovine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine IL-6 Specifications: (Molecular Weight: 20.4 kDa) (Amino Acid Sequence: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179)) (Gene ID: 443406). For research use only. Made in the USA
The Ovine & Caprine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine & Caprine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Ovine & Caprine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine & Caprine IL-8 Specifications: (Molecular Weight: 9.1 kDa) (Amino Acid Sequence: AVLSRMSTEL RCQCIKTHST PFHPKFIKEL RVIESGPHCE NSEIIVKLTN GKEVCLDPKE KWVQKVVQAF LKRAEKQDP (79)) (Gene ID: 443418). For research use only. Made in the USA
The Ovine LIF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine LIF applications are for cell culture, ELISA standard, and Western Blot Control. Ovine LIF yeast-derived recombinant protein can be purchased in multiple sizes. Ovine LIF Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: SPLPITPVNA TCATRHPCPS NLMNQIRNQL GQLNSSANSL FILYYTAQGE PFPNNLDKLC SPNVTDFPPF HANGTEKARL VELYRIIAYL GASLGNITRD QKVLNPYAHS LHSKLNATAD VLRGLLSNVL CRLCSKYHVS HVDVTYGPDT SGKDIFQKKK LGCQLLGKYK QVIAVLAQAF (180)) (Gene ID: 101110180). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
