Recombinant Proteins

Descrizione Azione

The Rabbit CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPC CFAYISRLLP RAHVTEYFYT SGKCSFPAVV FVTRKNRQVC ANPEKKWVRE YINSLEMS (68)) (Gene ID: 100348266). For research use only. Made in the USA

Codice: RP1201U-500
Dettagli

The Rabbit CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPC CFAYISRLLP RAHVTEYFYT SGKCSFPAVV FVTRKNRQVC ANPEKKWVRE YINSLEMS (68)) (Gene ID: 100348266). For research use only. Made in the USA

Codice: RP1201U-005
Dettagli

The Rabbit CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit CD40 Ligand Specifications: (Molecular Weight: 16.2 kDa) (Amino Acid Sequence: MQKGDQDPQI AAHLISEASS KSSSVLQWAK KGYYTMSNTL VTLENGKQLK VKRQGFYYIY AQVTFCSNQE PSSQAPFIAS LCLKSSGGSE RILLRAANAR SSSKTCEQQS IHLGGVFELQ ADASVFVNVT DASQVNHGTG FTSFGLLKL (149)) (Gene ID: 100358388). For research use only. Made in the USA

Codice: RP0990U-500
Dettagli

The Rabbit CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit CD40 Ligand Specifications: (Molecular Weight: 16.2 kDa) (Amino Acid Sequence: MQKGDQDPQI AAHLISEASS KSSSVLQWAK KGYYTMSNTL VTLENGKQLK VKRQGFYYIY AQVTFCSNQE PSSQAPFIAS LCLKSSGGSE RILLRAANAR SSSKTCEQQS IHLGGVFELQ ADASVFVNVT DASQVNHGTG FTSFGLLKL (149)) (Gene ID: 100358388). For research use only. Made in the USA

Codice: RP0990U-100
Dettagli

The Rabbit CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit CD40 Ligand Specifications: (Molecular Weight: 16.2 kDa) (Amino Acid Sequence: MQKGDQDPQI AAHLISEASS KSSSVLQWAK KGYYTMSNTL VTLENGKQLK VKRQGFYYIY AQVTFCSNQE PSSQAPFIAS LCLKSSGGSE RILLRAANAR SSSKTCEQQS IHLGGVFELQ ADASVFVNVT DASQVNHGTG FTSFGLLKL (149)) (Gene ID: 100358388). For research use only. Made in the USA

Codice: RP0990U-025
Dettagli

The Rabbit CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit CD40 Ligand Specifications: (Molecular Weight: 16.2 kDa) (Amino Acid Sequence: MQKGDQDPQI AAHLISEASS KSSSVLQWAK KGYYTMSNTL VTLENGKQLK VKRQGFYYIY AQVTFCSNQE PSSQAPFIAS LCLKSSGGSE RILLRAANAR SSSKTCEQQS IHLGGVFELQ ADASVFVNVT DASQVNHGTG FTSFGLLKL (149)) (Gene ID: 100358388). For research use only. Made in the USA

Codice: RP0990U-005
Dettagli

The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). For research use only. Made in the USA

Codice: RP1858U-005
Dettagli

The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). For research use only. Made in the USA

Codice: RP1858U-025
Dettagli

The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). For research use only. Made in the USA

Codice: RP1858U-100
Dettagli

The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). For research use only. Made in the USA

Codice: RP1858U-500
Dettagli

The Rabbit CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit CXCL10 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: MPLSRTVRCT CINISNKPVN PRSLEKLEII PASQSCANVE IIATMKKDGE KRCLNPELKA IKKLLKAFSK ERSRGSS (77)) (Gene ID: 100353112). For research use only. Made in the USA

Codice: RP0455U-005
Dettagli

The Rabbit CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit CXCL10 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: MPLSRTVRCT CINISNKPVN PRSLEKLEII PASQSCANVE IIATMKKDGE KRCLNPELKA IKKLLKAFSK ERSRGSS (77)) (Gene ID: 100353112). For research use only. Made in the USA

Codice: RP0455U-100
Dettagli