The Rabbit IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma Biotinylated applications are for cell culture. Rabbit IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144)) (Gene ID: 100008602). For research use only. Made in the USA
The Rabbit IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEH LKAYLKANTS DVANGGPLFL NILRNWKEES DNKIIQSQIV SFYFKLFDNL KDHEVIKKSM ESIKEDIFVK FFNSNLTKMD DFQNLTRISV DDRLVQRKAV SELSNVLNFL SPKSNLKKRK RSQTLFRGRR ASKY (144)) (Gene ID: 100008602). For research use only. Made in the USA
The Rabbit IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IL-13 Specifications: (Molecular Weight: 12.5 kDa) (Amino Acid Sequence: GPVPPPTSLK ELIEELVNIT HNQKAPLCNG TMVWSVNLTG SVYCAALESL VNVSGCNAIQ RTQRMLSGLC TDKAVAKQVT SVQARDTKIE LLQFLKELRR HLQMLYRLGK FR (112)) (Gene ID: 100358676). For research use only. Made in the USA
The Rabbit IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IL-16 Specifications: (Molecular Weight: 12.7 kDa) (Amino Acid Sequence: GLSPSSDSAA APSAASDVPA ESATEAAICT VTLEKTSAGL GFSLEGGRGS LRGDKPITIN RIFKGVASGP SATLQPGDEI LHVAGTALQG LTRFEAWNII KALPDGPVTV VIRRGLQPQG TVATGDP (127)) (Gene ID: 100356333). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
