Recombinant Proteins

Descrizione Azione

The Rabbit VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit VEGF-A Specifications: (Molecular Weight: 14.2 kDa) (Amino Acid Sequence: APMAEEGDNK PHEVVKFMEV YRRSYCQPIE TLVDIFQEYP DEIEYIFKPS CVPLVRCGGC CNDESLECVP TEEFNVTMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQEKCDKPR R (121)) (Gene ID: 100008899). For research use only. Made in the USA

Codice: RP0923U-500
Dettagli

The Rabbit VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit VEGF-A Specifications: (Molecular Weight: 14.2 kDa) (Amino Acid Sequence: APMAEEGDNK PHEVVKFMEV YRRSYCQPIE TLVDIFQEYP DEIEYIFKPS CVPLVRCGGC CNDESLECVP TEEFNVTMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQEKCDKPR R (121)) (Gene ID: 100008899). For research use only. Made in the USA

Codice: RP0923U-005
Dettagli

The Rabbit VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit VEGF-A Specifications: (Molecular Weight: 14.2 kDa) (Amino Acid Sequence: APMAEEGDNK PHEVVKFMEV YRRSYCQPIE TLVDIFQEYP DEIEYIFKPS CVPLVRCGGC CNDESLECVP TEEFNVTMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQEKCDKPR R (121)) (Gene ID: 100008899). For research use only. Made in the USA

Codice: RP0923U-025
Dettagli

The Rabbit VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit VEGF-A Specifications: (Molecular Weight: 14.2 kDa) (Amino Acid Sequence: APMAEEGDNK PHEVVKFMEV YRRSYCQPIE TLVDIFQEYP DEIEYIFKPS CVPLVRCGGC CNDESLECVP TEEFNVTMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQEKCDKPR R (121)) (Gene ID: 100008899). For research use only. Made in the USA

Codice: RP0923U-100
Dettagli

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 287437). For research use only. Made in the USA

Codice: RP0383R-005
Dettagli

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 287437). For research use only. Made in the USA

Codice: RP0383R-025
Dettagli

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 287437). For research use only. Made in the USA

Codice: RP0383R-500
Dettagli

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 287437). For research use only. Made in the USA

Codice: RP0383R-100
Dettagli

The Rat CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. Rat CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Rat CCL2 Specifications: (Molecular Weight: 14.1 kDa) (Amino Acid Sequence: QPDAVNAPLT CCYSFTGKMI PMSRLENYKR ITSSRCPKEA VVFVTKLKRE ICADPNKEWV QKYIRKLDQN QVRSETTVFY KIASTLRTSA PLNVNLTHKS EANASTLFST TTSSTSVEVT SMTEN (125)) (Gene ID: 24770). For research use only. Made in the USA

Codice: RP1746R-005
Dettagli

The Rat CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. Rat CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Rat CCL2 Specifications: (Molecular Weight: 14.1 kDa) (Amino Acid Sequence: QPDAVNAPLT CCYSFTGKMI PMSRLENYKR ITSSRCPKEA VVFVTKLKRE ICADPNKEWV QKYIRKLDQN QVRSETTVFY KIASTLRTSA PLNVNLTHKS EANASTLFST TTSSTSVEVT SMTEN (125)) (Gene ID: 24770). For research use only. Made in the USA

Codice: RP1746R-025
Dettagli

The Rat CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. Rat CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Rat CCL2 Specifications: (Molecular Weight: 14.1 kDa) (Amino Acid Sequence: QPDAVNAPLT CCYSFTGKMI PMSRLENYKR ITSSRCPKEA VVFVTKLKRE ICADPNKEWV QKYIRKLDQN QVRSETTVFY KIASTLRTSA PLNVNLTHKS EANASTLFST TTSSTSVEVT SMTEN (125)) (Gene ID: 24770). For research use only. Made in the USA

Codice: RP1746R-100
Dettagli

The Rat CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Rat CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Rat CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APIGSDPPTS CCFSYTSRKI HRNFVMDYYE TSSLCSQPAV VFLTKKGRQI CADPSEPWVN EYVNDLELN (69)) (Gene ID: 116637). For research use only. Made in the USA

Codice: RP0866R-025
Dettagli