The Swine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL11 Specifications: (Molecular Weight: 8.4 kDa) (Amino Acid Sequence: QPASVATICC FNVTRKKIPT QRLQSYQRVT ANKCPQNAVI FSTRQAKKIC ADAQENWVQN AMEYLDQKSK TVKS (74)) (Gene ID: 100038010). For research use only. Made in the USA
The Swine CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL17 applications are for cell culture, ELISA Standard, ELISpot Control, and Western Blot Control. Swine CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL17 Specifications: (Molecular Weight:9.0 kDa) (Amino Acid Sequence:ARGTNVGREC CLEYFKGAIP LRKLVGWYQT SDECTRDAIV LVTFQGRAIC SDPKDTWVKK AIRYLKKNMK PQDPVTQKS). For research use only. Made in the USA.
The Swine CCL19 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL19 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CCL19 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL19 Specifications: (Molecular Weight: 8.8 kDa) (Amino Acid Sequence: DANDAEDCCL SVTQHPIPGN LVRAFRYLLI RDGCRLPAVV FTTLKGRELC APPGQPWVER IIKRLKRKSA KSKHHRN (77)) (Gene ID: 494464). For research use only. Made in the USA
The Swine CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL20 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: ASNFDCCLRYTDHILHPRFIMGFTQQLANEACDINAIIFYTKKKLAVCADPQKIWVKQAVNILSQRVKKM) (Gene ID: 553951). For research use only. Made in the USA
The Swine CCL25 / TECK yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL25 / TECK applications are for cell culture, ELISA standard, and Western Blot Control. Swine CCL25 / TECK yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL25 / TECK Specifications: (Molecular Weight: 6.1 kDa) (Amino Acid Sequence: QGAFEDCCLA YHSHIKWRLL RRAHSYQRQD VSGSCNLPAV IFFFPQKDKM VC (52)) (Gene ID: 448799). For research use only. Made in the USA
The Swine CCL28 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL28 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL28 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL28 Specifications: (Molecular Weight: 12.2 kDa) (Amino Acid Sequence: ILPIASSCCT EVSHHISRRL LERVNTCRLQ RADGDCDLAA VILHVKRRRI CVSPHNHLIK QWMKEQAAKK DAKGNICHKK KHHSKRNSKG AHQEKHETHG HKTPY (105)) (Gene ID: 554303). For research use only. Made in the USA
The Swine CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL2 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDAINSPVT CCYTLTSKKI SMQRLMSYRR VTSSKCPKEA VIFKTIAGKE ICAEPKQKWV QDSISHLDKK NQTPKP) (Gene ID: 397422). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
