The Swine CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL2 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDAINSPVT CCYTLTSKKI SMQRLMSYRR VTSSKCPKEA VIFKTIAGKE ICAEPKQKWV QDSISHLDKK NQTPKP) (Gene ID: 397422). For research use only. Made in the USA
The Swine CCL3L1 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 Biotinylated applications are for cell culture. Swine CCL3L1 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Biotinylated Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459). For research use only. Made in the USA
The Swine CCL3L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL3L1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459). For research use only. Made in the USA
The Swine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTSCCFTYTVRKLPRNFVTDYYETSSLCSQPAVVFQTKKGRQVCANPSDDWVQEYMDDLELN) (Gene ID: 396668). For research use only. Made in the USA
The Swine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS) (Gene ID: 396613). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
