Recombinant Proteins

Descrizione Azione

The Swine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS) (Gene ID: 396613). For research use only. Made in the USA

Codice: RP0059S-500
Dettagli

The Swine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSIPIT CCFGLVNGKI PFKKLESYTR ITNSQCPQEA VIFKTKADKE VCADPQQKWV QNSMKLLDQK SQTPKP (76)) (Gene ID: 100302703). For research use only. Made in the USA

Codice: RP1936S-005
Dettagli

The Swine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSIPIT CCFGLVNGKI PFKKLESYTR ITNSQCPQEA VIFKTKADKE VCADPQQKWV QNSMKLLDQK SQTPKP (76)) (Gene ID: 100302703). For research use only. Made in the USA

Codice: RP1936S-500
Dettagli

The Swine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSIPIT CCFGLVNGKI PFKKLESYTR ITNSQCPQEA VIFKTKADKE VCADPQQKWV QNSMKLLDQK SQTPKP (76)) (Gene ID: 100302703). For research use only. Made in the USA

Codice: RP1936S-100
Dettagli

The Swine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSIPIT CCFGLVNGKI PFKKLESYTR ITNSQCPQEA VIFKTKADKE VCADPQQKWV QNSMKLLDQK SQTPKP (76)) (Gene ID: 100302703). For research use only. Made in the USA

Codice: RP1936S-025
Dettagli

The Swine CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Swine CD40 Ligand Specifications: (Molecular Weight: 16.0 kDa) (Amino Acid Sequence: MHKGDQDPQI AAHVISEASS KTASVLQWAP KGYYTLSTNL VTLENGRQLA VKRQGIYYIY AQVTFCSNRD AAGQAPFIAS LCLRSPSGSE RILLRAANTH SSSKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL (149)) (Gene ID: 397231). For research use only. Made in the USA

Codice: RP0936S-100
Dettagli

The Swine CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Swine CD40 Ligand Specifications: (Molecular Weight: 16.0 kDa) (Amino Acid Sequence: MHKGDQDPQI AAHVISEASS KTASVLQWAP KGYYTLSTNL VTLENGRQLA VKRQGIYYIY AQVTFCSNRD AAGQAPFIAS LCLRSPSGSE RILLRAANTH SSSKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL (149)) (Gene ID: 397231). For research use only. Made in the USA

Codice: RP0936S-500
Dettagli

The Swine CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Swine CD40 Ligand Specifications: (Molecular Weight: 16.0 kDa) (Amino Acid Sequence: MHKGDQDPQI AAHVISEASS KTASVLQWAP KGYYTLSTNL VTLENGRQLA VKRQGIYYIY AQVTFCSNRD AAGQAPFIAS LCLRSPSGSE RILLRAANTH SSSKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL (149)) (Gene ID: 397231). For research use only. Made in the USA

Codice: RP0936S-025
Dettagli

The Swine CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Swine CD40 Ligand Specifications: (Molecular Weight: 16.0 kDa) (Amino Acid Sequence: MHKGDQDPQI AAHVISEASS KTASVLQWAP KGYYTLSTNL VTLENGRQLA VKRQGIYYIY AQVTFCSNRD AAGQAPFIAS LCLRSPSGSE RILLRAANTH SSSKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL (149)) (Gene ID: 397231). For research use only. Made in the USA

Codice: RP0936S-005
Dettagli

The Swine sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Swine sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine sCTLA-4 Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: MHVAQPAVVL ANSRGVASFV CEYGSAGKAA EVRVTVLRRA GSQMTEVCAA TYTVEDELTF LDDSTCTGTS TENKVNLTIQ GLRAVDTGLY ICKVELLYPP PYYVGMGNGT QIYVIDPEPC PDSD (124)) (Gene ID: 397286). For research use only. Made in the USA

Codice: RP1534S-005
Dettagli

The Swine sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Swine sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine sCTLA-4 Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: MHVAQPAVVL ANSRGVASFV CEYGSAGKAA EVRVTVLRRA GSQMTEVCAA TYTVEDELTF LDDSTCTGTS TENKVNLTIQ GLRAVDTGLY ICKVELLYPP PYYVGMGNGT QIYVIDPEPC PDSD (124)) (Gene ID: 397286). For research use only. Made in the USA

Codice: RP1534S-025
Dettagli

The Swine sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Swine sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine sCTLA-4 Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: MHVAQPAVVL ANSRGVASFV CEYGSAGKAA EVRVTVLRRA GSQMTEVCAA TYTVEDELTF LDDSTCTGTS TENKVNLTIQ GLRAVDTGLY ICKVELLYPP PYYVGMGNGT QIYVIDPEPC PDSD (124)) (Gene ID: 397286). For research use only. Made in the USA

Codice: RP1534S-100
Dettagli