The Bovine IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-2 Specifications: (Molecular Weight: 15.5 kDa) (Amino Acid Sequence: APTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMHTFDFYVPKVNATELKHLKCLLEELKLLEEVLNLAPSKNLNPREIKDSMDNIKRIVLELQGSETRFTCEYDDATVNAVEFLNKWITFCQSIYSTMT) (Gene ID: 280822). For research use only. Made in the USA
The Bovine IL-36 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-36 alpha applications are for cell culture, ELISA standard, and Western Blot Control. Bovine IL-36 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-36 alpha Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: NIQDINHLVW VLQGQALTAV PRKDQMDPVT VTLVSCKYTE TLEKGRGNPV YLGLKEPELC LFCTKVKGQP TLQLQERNIM DLYHQTEPVK PFLFYHDQNG RASSFESVAF PGWFIGSCSC GGCPVIITQE LGKIYTTDFG FTVLQP (146)) (Gene ID: 523429). For research use only. Made in the USA
The Bovine IL-36 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-36 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-36 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-36 Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD) (Gene ID: 518514). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.