The Swine Prolactin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine Prolactin applications are for cell culture, ELISA standard, and Western Blot Control. Swine Prolactin yeast-derived recombinant protein can be purchased in multiple sizes. Swine Prolactin Specifications: (Molecular Weight: 23.0 kDa) (Amino Acid Sequence: LPICPSGAVN CQVSLRDLFD RAVILSHYIH NLSSEMFNEF DKRYAQGRGF ITKAINSCHT SSLSTPEDKE QAQQIHHEVL LNLILRVLRS WNDPLYHLVT EVRGMQEAPD AILSRAIEIE EQNKRLLEGM EKIVGQVHPG IKENEVYSVW SGLPSLQMAD EDTRLFAFYN LLHCLRRDSH KIDNYLKLLK CRIIYDSNC (199)) (Gene ID: 396965). For research use only. Made in the USA
The Swine SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine SCF applications are for cell culture, ELISA standard, and Western Blot Control. Swine SCF yeast-derived recombinant protein can be purchased in multiple sizes. Swine SCF Specifications: (Molecular Weight: 18.7 kDa) (Amino Acid Sequence: QGICRNRVTD DVKDVTKLVA NLPKDYKITL KYVPGMDVLP SHCWISEMVE QLSVSLTDLL DKFSNISEGL SNYSIIDKLV KIVDDLVECM EEHSFENVRK SSKSPEPRLF TPEKFFGIFN RSIDAFKDLE MVAPKTSECV ISSTLTPEKD SRVSVTKPFM LPPVAA (166)) (Gene ID: 397509). For research use only. Made in the USA
The Swine TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha Biotinylated applications are for cell culture. Swine TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086). For research use only. Made in the USA
The Swine TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Swine TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
