The Bovine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572). For research use only. Made in the USA
The Anole IGF-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Anole IGF-1 applications are for cell culture, ELISA standard, and Western Blot Control. Anole IGF-1 yeast-derived recombinant protein can be purchased in multiple sizes. Anole IGF-1 Specifications: (Molecular Weight: 7.7 kDa) (Amino Acid Sequence: SSETLCGAEL VDALQFVCGE RGFYFSKPAG YGGNRRSVTR GIVDECCFQS CDLTRLEMYC APAKRDKTAR (70)) (Gene ID: n/a). For research use only. Made in the USA
The Anole IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Anole IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. Anole IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Anole IGF-2 Specifications: (Molecular Weight: 7.6 kDa) (Amino Acid Sequence: SHGPAETLCG GELVDTLQFV CGDRGFYFSR PVGRNRGRLN RGIVEECCFR SCDLNLLETY CAKSVKSE (68)) (Gene ID: n/a). For research use only. Made in the USA
The Canine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Canine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Canine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SVRVEQVVKP MKNKTESEKT SDKPKRKKKG GKSGKNRRNR KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 475176). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
