The Canine SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Canine SCF yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 403507). For research use only. Made in the USA
The Canine TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine TNF alpha Biotinylated applications are for cell culture. Canine TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine TNF alpha Biotinylated Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: VKSSSRTPSD KPVAHVVANP EAEGQLQWLS RRANALLANG VELTDNQLIV PSDGLYLIYS QVLFKGQGCP STHVLLTHTI SRFAVSYQTK VNLLSAIKSP CQRETPEGTE AKPWYEPIYL GGVFQLEKGD RLSAEINLPN YLDFAESGQV YFGIIAL (157)) (Gene ID: 403922). For research use only. Made in the USA
The Canine TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Canine TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Canine TNF alpha Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: VKSSSRTPSD KPVAHVVANP EAEGQLQWLS RRANALLANG VELTDNQLIV PSDGLYLIYS QVLFKGQGCP STHVLLTHTI SRFAVSYQTK VNLLSAIKSP CQRETPEGTE AKPWYEPIYL GGVFQLEKGD RLSAEINLPN YLDFAESGQV YFGIIAL (157)) (Gene ID: 403922). For research use only. Made in the USA
The Canine TNFSF11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine TNFSF11 applications are for cell culture, ELISA standard, and Western Blot Control. Canine TNFSF11 yeast-derived recombinant protein can be purchased in multiple sizes. Canine TNFSF11 Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: EKAMMEGSWL EMARRGKTHT QPFAHLTINA TDIPSGSHKV SLSSWYHDRG WAKISNMTFS NGKLIVNQDG FYFLYANICF RHHETSGDLA TEYLQLMVYV TKTSIKIPSS HTLMKGGSTK YWSGNSEFHF YSINVGGFFK LRSGEEISIE VSNPSLLDPD QDATYFGAFK VLDID (175)) (Gene ID: 609418). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.