The Egyptian Rousette Bat IL-19 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat IL-19 applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat IL-19 yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat IL-19 Specifications: (Molecular Weight: 20.2 kDa) (Amino Acid Sequence: MKAQHASLWF LGAVFFLCSV HTRGLRRCLI SMDMHHIEES FREIKGAIQA KDIFQNVTIL STSEILSSVK PLGVCCMTKN LLAFYMDRVF KDHQELNPQI LRKISSIANS FLYMQKALQQ CQEQRLCHCG QEATNATRII HDNYNQLEVQ SAALKSLGEL DIFLAWIHKN HQGTSTA). For research use only. Made in the USA
The Jamaican fruit-eating Bat FLT3 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican fruit-eating Bat FLT3 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican fruit-eating Bat FLT3 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican fruit-eating Bat FLT3 Ligand Specifications: (Molecular Weight: 16.0 kDa) (Amino Acid Sequence: RTPDCTFPHS PISSTFADTI RKLSDYLLED YPVTVATNLH DDKLCWAFWR LVLAQRCMER LKTVAGSQMQ QLLEDVNTEI YFVTSCALQD TSEQLVALKP WITRWNFSGC LELRCQPDSS TLLPSRSPKA LEATALPAAQ AP (142)) (Gene ID: 119046007). For research use only. Made in the USA
The Flying Fox Bat IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Flying Fox Bat IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. Flying Fox Bat IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Flying Fox Bat IL-4 Specifications: (Molecular Weight: 12.8 kDa) (Amino Acid Sequence: HRYSITLEEI IKTLNILTTR KDWCMELMVA DVFAAPKNTA EEEIFCRAVT VLRKVYKHHE CVNRKFLGKL DRNLRSMARD YCPVEEAKKD TLKNVLETLR KTMQEKYSKS WS). For research use only. Made in the USA
The Jamaican fruit-eating Bat GM-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican fruit-eating Bat GM-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican fruit-eating Bat GM-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican fruit-eating Bat GM-CSF Specifications: (Molecular Weight: 14.3 kDa) (Amino Acid Sequence: APIHPPSLVT RHFVHVDTIK EALTLLNTSD ITEVMNETVE VVSETFDPKE PTCLQTRLEL YQQGLRGNLT ILEGPLTLMA QHYGQHCPPT PETSCATQIT TFKNFKENLN NFLLIIPFDC WSTIQE (126)) (Gene ID: 119037675). For research use only. Made in the USA
The Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Common Vampire Bat IFN lambda 3 applications are for cell culture, ELISA standard, and Western Blot Control. Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein can be purchased in multiple sizes. Common Vampire Bat IFN lambda 3 Specifications: (Molecular Weight: 23.4 kDa) (Amino Acid Sequence: PPPLLTLSMP SLVSPSINTD LPVGCTLVLM LMTTVLTRTA AVPVPTPLSA LPGARGCVVA QFKFLAPQDMKAFRRAKDTLEELLLPKNRSCSSRPFPRTRDLRQLQVWERPVALEAELALTLKVLGSIANSTLGDILDQPLHMLRYIHTKLQACVPAQATAGPRPRGHLHHWLHRLQEASKKESTGCLEASVTFNLFRLLTHDLQCVASGGLCI (214)) (Gene ID: 112340026). For research use only. Made in the USA
The Common vampire Bat IL-22 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Common vampire Bat IL-22 applications are for cell culture, ELISA standard, and Western Blot Control. Common vampire Bat IL-22 yeast-derived recombinant protein can be purchased in multiple sizes. Common vampire Bat IL-22 Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: ALPIGSHCRL DKSNFQQPYI TNHTFMLANE ASLADNNTDV RLIGEKLFRG VNMSEHCYLM KQVLNFIVEE VLLPESDRFQ PYMQEVVPFM ARLSNNLSQC RIESGDQHIR RNVQQLKDTV EKLGESGKIK AIGEVNLLFM FLRNACI (147)) (Gene ID: 112319158). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
