The Chicken IL-22 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-22 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-22 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-22 Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: SPLPPKGTGV VSNAHQACRL RKINFQQPYI RNRTYTLAEM ARLSDQDTDN RLIGQQIYVN IRENNRCYMM KRITEIIVKD VLLTEAKERY PYAEDVAQFL ASLTSELSRC KYSGNREHIE KNLEEMKSKM KELGENGKNK AIGELDLLFD YIENACTDAP KKGGNKKKN (169)) (Gene ID: 417838). For research use only. Made in the USA
The Chicken IL-2 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 Biotinylated applications are for cell culture. Chicken IL-2 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Biotinylated Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958). For research use only. Made in the USA
The Chicken IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958). For research use only. Made in the USA
The Chicken IL-34 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-34 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken IL-34 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-34 Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence: ECELARLLQD KLRYEMRLQY MKHNFPIDYT LRVQHEEVLR TANVTRLRDG KVSEASLRYL WFHACSQAVL HILEVLPEKH PSRGYTQELS QLLDALGVEY SGYRQSDVDA VVADLVKQLH SGDSRQKAVR PKALLDNCLK VLRMLFGAHC RWDSA (155)) (Gene ID: 100858424). For research use only. Made in the USA
The Chicken IL-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-3 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken IL-3 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-3 Specifications: (Molecular Weight: 13.9 kDa) (Amino Acid Sequence: SPLPLDKDCP STSSLSEVIE DVEKLQGSNE AIPPNNIILM MEQGEENAVT YLEEFIRALE SSKKQIKKDF LRNLQKIYST GKNCTGWLIH NWEPMESDDF FKNFEELLKF LNMYGVSKKT S (121)) (Gene ID: 474356). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
