The Bovine/Ovine/Caprine BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine/Ovine/Caprine BAFF applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine/Ovine/Caprine BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Bovine/Ovine/Caprine BAFF Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: ALQEAEETVT QDCLQLIADS DTPTIRKGAY TFVPWLLSFK RGRALEEKEN KILVKETGYF FIYGQVLYTD NTFAMGHLIQ RKKVHVFGDE LSLVTLFRCI QNMPETLPNN SCYSAGIAKL EEGDELQLAI PREDAKISRD GDGTFFGALK LL (152)) (Gene ID: 504507). For research use only. Made in the USA
The Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 (Eotaxin-1) Biotinylated applications are for cell culture. Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 (Eotaxin-1) Biotinylated Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072). For research use only. Made in the USA
The Bovine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072). For research use only. Made in the USA
The Bovine CCL14 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL14 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL14 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL14 Specifications: (Molecular Weight: 15.3 kDa) (Amino Acid Sequence: SKNGSSSRGP YHPAECCLTY VSRPVPRQRV SSYYETSSQC PKPGIIFITK KGHYICANPR DGWVQDYIKE LEE (73)) (Gene ID: 616723). For research use only. Made in the USA
The Bovine CCL16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL16 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL16 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL16 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: QPKIPESVNP PPNCCLKYHE KVLPRKLVVG YRQALNCHLP AIVFITKRKR EVCTNPNNDW VQEYIKDPRL HPRHSRRLA). For research use only. Made in the USA.
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
