Recombinant Proteins

Descrizione Azione

The Equine CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL2 Specifications: (Molecular Weight: 8.5 kDa) (Amino Acid Sequence: QPDAINSPVT CCYTFTGKKI SSQRLGSYKR VTSSKCPKEA VIFKTILAKE ICADPEQKWV QDAVKQLDKK AQTPKP) (Gene ID: 100034136). For research use only. Made in the USA

Codice: RP0054E-025
Dettagli

The Equine CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL2 Specifications: (Molecular Weight: 8.5 kDa) (Amino Acid Sequence: QPDAINSPVT CCYTFTGKKI SSQRLGSYKR VTSSKCPKEA VIFKTILAKE ICADPEQKWV QDAVKQLDKK AQTPKP) (Gene ID: 100034136). For research use only. Made in the USA

Codice: RP0054E-005
Dettagli

The Equine CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL2 Specifications: (Molecular Weight: 8.5 kDa) (Amino Acid Sequence: QPDAINSPVT CCYTFTGKKI SSQRLGSYKR VTSSKCPKEA VIFKTILAKE ICADPEQKWV QDAVKQLDKK AQTPKP) (Gene ID: 100034136). For research use only. Made in the USA

Codice: RP0054E-100
Dettagli

The Equine CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: VPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA) (Gene ID: 100057909). For research use only. Made in the USA

Codice: RP0065E-025
Dettagli

The Equine CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: VPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA) (Gene ID: 100057909). For research use only. Made in the USA

Codice: RP0065E-005
Dettagli

The Equine CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: VPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA) (Gene ID: 100057909). For research use only. Made in the USA

Codice: RP0065E-500
Dettagli

The Equine CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: VPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA) (Gene ID: 100057909). For research use only. Made in the USA

Codice: RP0065E-100
Dettagli

The Equine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTA CCFSYTLRKL PRNFVVDYYE TSSLCSQPAV VFQTKKGRQV CANPSDDWVQ EYMDDLELN (69)) (Gene ID: 100057859). For research use only. Made in the USA

Codice: RP0981E-100
Dettagli

The Equine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTA CCFSYTLRKL PRNFVVDYYE TSSLCSQPAV VFQTKKGRQV CANPSDDWVQ EYMDDLELN (69)) (Gene ID: 100057859). For research use only. Made in the USA

Codice: RP0981E-025
Dettagli

The Equine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTA CCFSYTLRKL PRNFVVDYYE TSSLCSQPAV VFQTKKGRQV CANPSDDWVQ EYMDDLELN (69)) (Gene ID: 100057859). For research use only. Made in the USA

Codice: RP0981E-005
Dettagli

The Equine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS) (Gene ID: 100033925). For research use only. Made in the USA

Codice: RP0070E-005
Dettagli

The Equine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS) (Gene ID: 100033925). For research use only. Made in the USA

Codice: RP0070E-025
Dettagli