The Equine CXCL6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL6 applications are for cell culture, ELISA standard, and Western Blot Control. Equine CXCL6 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL6 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: GPVAAAVREL RCMCLTVTPG IHPKMISSLQ VFAVGPQCSK VEVVATLKNK KEVCLDPEAP LIKKFIQKTL DSGNKKN (77)) (Gene ID: 100033988). For research use only. Made in the USA
The Equine CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Equine CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL7 Specifications: (Molecular Weight: 11.2 kDa) (Amino Acid Sequence: TITIGEISTL AKSVDDELYA ELRCLCVKTT SGIHPRIIQT LQVIRAGPHC SKVEVIATLK NGKEICLDPG AVRIKNIVQK ILESDGSAAS SVHILSNLSD SQEE (104)) (Gene ID: 103566766). For research use only. Made in the USA
The Equine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL9 Specifications: (Molecular Weight: 12.0 kDa) (Amino Acid Sequence: APVMRKGRCSCIKTSQGTIRPKLLKDLKQFAPSPSCETTEIIATMKNGDQTCLNPDSAEVKELIKEWEKQVSQKKKQKKGKKHQKTKKFPKVKKWQRPRQKKAT) (Gene ID: 100057927). For research use only. Made in the USA
The Equine EGF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine EGF applications are for cell culture, ELISA standard, and Western Blot Control. Equine EGF yeast-derived recombinant protein can be purchased in multiple sizes. Equine EGF Specifications: (Molecular Weight: 5.4 kDa) (Amino Acid Sequence: NSYQECSQSY DGYCLHGGKC VYLVQVDTHA CNCVVGYVGE RCQHQDLR (48)) (Gene ID: 106782874). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
