The Equine IFN beta 1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IFN beta 1 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IFN beta 1 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IFN beta 1 Specifications: (Molecular Weight: 19.5 kDa) (Amino Acid Sequence: VNYDLLRSQL RSSNSACLML LRQLNGAPQR CPEDTMNFQV PEEIEQAQQF QKEDAALVIY EMLQHTWRIF RRNFASTGWN ETIVKNLLVE VHLQMDRLET NLEEIMEEES STWGNTTILR LKKYYGRISQ YLKAKKYSHC AWTVVQAEML RNLAFLNGLT DYLQN (165)) (Gene ID: 100052545). For research use only. Made in the USA
The Equine IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Equine IFN gamma Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: YYCQAAFFKE IENLKEYFNA SNPDVGDGGP LFLDILKNWK EDSDKKIIQS QIVSFYFKLF ENLKDNQVIQ KSMDTIKEDL FAKFFNSSTS KLEDFQKLIQ IPVNDLKVQR KAISELIKVM NDLSPKANLR KRKRSQNPFR GRRALQ (146)) (Gene ID: 100034181). For research use only. Made in the USA
The Equine IL-10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-10 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-10 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-10 Specifications: (Molecular Weight: 18.6 kDa) (Amino Acid Sequence: SRDRGTQSEN SCTHFPTSLP HMLHELRAAF SRVKTFFQMK DQLDNMLLNG SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENHGPDIKEH VNSLGEKLKT LRVRLRRCHR FLPCENKSKA VEQVKSAFSK LQEKGVYKAM SEFDIFINYI EAYMTTKMKN (170)) (Gene ID: 100034187). For research use only. Made in the USA
The Equine IL-12/IL-23 p40 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-12/IL-23 p40 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-12/IL-23 p40 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-12/IL-23 p40 Specifications: (Molecular Weight: 34.9 kDa) (Amino Acid Sequence: IWELEKDVYV VELDWYPDAP GEMVVLTCNT PEEEGITWTS AQSNEVLGSG KTLTIQVKEF GDAGWYTCHK GGEVLSHSHL LLHKKEDGIW STDILKDQKE SKNKTFLKCE AKNYSGRFTC WWLTAISTDL KFSVKSSRGS SDPRGVTCGA ATLSAERVSV DDREYKKYTV ECLEGSACPA AEESLPIEIV VDAVHKLKYE NYTSGFFIRD IIKPDPPKNL QLKPLKNSRQ VEVSWEYPET WSTPHSYFSL TFSIQVQGKN KKERKDRLFM DETSATVTCH KDGQIRVQAR DRYYSSSWSE WASVSCS (307)) (Gene ID: 100034222). For research use only. Made in the USA
The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA
Inserisci la tua e-mail e seleziona le aree di interesse per ricevere le ultime novità, approfondimenti e promozioni.
Seleziona uno o più ambiti di interesse per ricevere comunicazioni più utili e mirate.
2025 TEMA Ricerca - All Rights Reserved.
