Recombinant Proteins

Recombinant Proteins

Descrizione	Azione
The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA Equine IL-13 Recombinant Protein Codice: RP0102E-500	Dettagli
The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA Equine IL-13 Recombinant Protein Codice: RP0102E-100	Dettagli
The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA Equine IL-13 Recombinant Protein Codice: RP0102E-025	Dettagli
The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA Equine IL-13 Recombinant Protein Codice: RP0102E-005	Dettagli
The Equine IL-15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-15 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-15 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-15 Specifications: (Molecular Weight: 13.0 kDa) (Amino Acid Sequence: NWQDVISDLK RIEDLIQSIH VDATLYTESD AHPNCKVTAM KCFLLELHVI SHESRNEDIK ETVENLIILA NSSLSSNGNV TESGCKECEE LEEKNIKEFL QSFVHIVQMF INPS (114)) (Gene ID: 100034058). For research use only. Made in the USA Equine IL-15 Recombinant Protein Codice: RP0044E-025	Dettagli
The Equine IL-15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-15 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-15 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-15 Specifications: (Molecular Weight: 13.0 kDa) (Amino Acid Sequence: NWQDVISDLK RIEDLIQSIH VDATLYTESD AHPNCKVTAM KCFLLELHVI SHESRNEDIK ETVENLIILA NSSLSSNGNV TESGCKECEE LEEKNIKEFL QSFVHIVQMF INPS (114)) (Gene ID: 100034058). For research use only. Made in the USA Equine IL-15 Recombinant Protein Codice: RP0044E-005	Dettagli
The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142). For research use only. Made in the USA Equine IL-17A Recombinant Protein Codice: RP0078E-500	Dettagli
The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142). For research use only. Made in the USA Equine IL-17A Recombinant Protein Codice: RP0078E-100	Dettagli
The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142). For research use only. Made in the USA Equine IL-17A Recombinant Protein Codice: RP0078E-025	Dettagli
The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142). For research use only. Made in the USA Equine IL-17A Recombinant Protein Codice: RP0078E-005	Dettagli
The Equine IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. Equine IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-18 Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence:YFGRLEPKLS IIRNLNDQVL FINQGNQPVF EDMPDSDCTD NAPQTVFIIY MYKDSLTRGL AVTISVKCEK TSTLSCKNKI ISFKEMSPPE NINDEGNDII FFQRSVPGHD DKIQFESSLY KGYFLACEKE NDLFKLILKE KDENGDKSVM FTVQNQN). For research use only. Made in the USA Equine IL-18 Recombinant Protein Codice: RP2218E-025	Dettagli
The Equine IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. Equine IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-18 Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence:YFGRLEPKLS IIRNLNDQVL FINQGNQPVF EDMPDSDCTD NAPQTVFIIY MYKDSLTRGL AVTISVKCEK TSTLSCKNKI ISFKEMSPPE NINDEGNDII FFQRSVPGHD DKIQFESSLY KGYFLACEKE NDLFKLILKE KDENGDKSVM FTVQNQN). For research use only. Made in the USA Equine IL-18 Recombinant Protein Codice: RP2218E-100	Dettagli

1…89 90 919293 94 95…228

Marca

Conservazione

Tipo di campione

Confezionamento (campo)

Simbolo target

Reset

2025 TEMA Ricerca - All Rights Reserved.