The Equine IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. Equine IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-18 Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence:YFGRLEPKLS IIRNLNDQVL FINQGNQPVF EDMPDSDCTD NAPQTVFIIY MYKDSLTRGL AVTISVKCEK TSTLSCKNKI ISFKEMSPPE NINDEGNDII FFQRSVPGHD DKIQFESSLY KGYFLACEKE NDLFKLILKE KDENGDKSVM FTVQNQN). For research use only. Made in the USA
The Equine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 alpha Specifications: (Molecular Weight: 18.1 kDa) (Amino Acid Sequence: SVHYNFQSNT KYNFMRIVNH QCTLNDALNQ SVIRDTSGQY LATAALNNLD DAVKFDMGAY TSEEDSQLPV TLRISKTRLF VSAQNEDEPV LLKEMPDTPK TIKDETNLLF FWERHGSKNY FKSVAHPKLF IATKQGKLVH MARGQPSITD FQILDNQF (158)) (Gene ID: 100064969). For research use only. Made in the USA
The Equine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 beta Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: AAVHSVNCRLRDIYHKSLVLSGACELQAVHLNGENTNQQVVFCMSFVQGEEETDKIPVALGLKEKNLYLSCGMKDGKPTLQLETVDPNTYPKRKMEKRFVFNKMEIKGNVEFESAMYPNWYISTSQAEKKPVFLGNTRGGRDITDFIMEITSA) (Gene ID: 100034237). For research use only. Made in the USA
The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152)) (Gene ID: 100034236). For research use only. Made in the USA
The Equine IL-28B yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-28B applications are for cell culture, ELISA standard, and Western Blot Control. Equine IL-28B yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-28B Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: GPVPTSKPAT TQRSCDIGRF KSLSPSELEA FKKAKDALEN SLENWTCRSP VFPTTWDLRQ LQVWERPVAL EAELALTLKI LAMVADSSLA DILDRPLHTL RHIHSELQAC VPARPTAGPG PRGRLHQWLR QLHEVQKKES WGCLEASVTF NLFRLLTRDL NCVASGDLCL (170)) (Gene ID: 100146825). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
