The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). For research use only. Made in the USA
Rabbit CXCL10 ELISpot contains Capture Antibody, Standard Control, and Detection Antibody for development of up to two (2) ELISpot assays. Other required materials and reagents are not supplied. The antibodies have been determined to function in an ELISpot with the Standard Control provided. Components may also be purchased separately. For research use only. Made in the USA
The Rabbit CXCL10 (IP-10) ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit CXCL10 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for the ELISA have not been determined. This allows for complete flexibility to provide optimal dynamic range and sensitivity based on your sample type. Alternate names include CXCL10, C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1, C-X-C motif chemokine ligand 10, C-X-C motif chemokine 10. The quantities of components provided are not matched. Components may also be purchased separately. For research use only. Made in the USA
Inserisci la tua e-mail e seleziona le aree di interesse per ricevere le ultime novità, approfondimenti e promozioni.
Seleziona uno o più ambiti di interesse per ricevere comunicazioni più utili e mirate.
2025 TEMA Ricerca - All Rights Reserved.
