The Rabbit IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN beta Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: MSYNSLQIQL WHGSLTCAKL LLQLNGTTED CLNERINFKV PKEIKEPQQL QKEDTTLVIF EMLNNIFDIF RKNFSSTGWN ETLVENLLGE THLQIHHLKS KINKKVTLES IRMNLRLKSY YWRIMDYLET KQYSNCAWKI VQLEIFRNFS FIIMLIDYL (159)) (Gene ID: 100342931). For research use only. Made in the USA
The Rabbit IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma Biotinylated applications are for cell culture. Rabbit IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144)) (Gene ID: 100008602). For research use only. Made in the USA
The Rabbit IFN-gamma ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IFN gamma ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for the ELISA have not been determined. This allows for complete flexibility to provide optimal dynamic range and sensitivity based on your sample type. Alternate names include IFNG, IFG, IFI, interferon, gamma, interferon gamma. The quantities of components provided are not matched. Components may also be purchased separately. For research use only. Made in the USA
Rabbit IFN gamma ELISpot contains Capture Antibody, Standard Control, and Detection Antibody for development of up to two (2) ELISpot assays. Other required materials and reagents are not supplied. The antibodies have been determined to function in an ELISpot with the Standard Control provided. Components may also be purchased separately. For research use only. Made in the USA
The Rabbit IFN gamma polyclonal antibody is unlabeled and has been qualified for use in ELISA and Western blot applications. It is the capture antibody in the Kingfisher Biotech Rabbit IFN gamma ELISA. The Rabbit IFN gamma antibody was produced in chickens and is antigen-affinity purified. The reactivity by species is: (Bovine IFN gamma - None) (Canine IFN gamma - None) (Caprine IFN gamma - None) (Chicken IFN gamma - None) (Dolphin IFN gamma - Weak) (Equine IFN gamma - None) (Feline IFN gamma - None) (Ferret IFN gamma - None) (Human IFN gamma - Weak) (Mouse IFN gamma - None) (Ovine IFN gamma - None) (Rabbit IFN gamma - Strong) (Swine IFN gamma - None) (Zebrafish IFN gamma 1-1 - None) (Zebrafish IFN gamma 1-2 - None). For research use only. Made in the USA
The Rabbit IFN gamma polyclonal antibody is labeled and has been qualified for use in ELISA. It is the detection antibody in the Kingfisher Biotech Rabbit IFN gamma ELISA. The Rabbit IFN gamma antibody was produced in chickens and is antigen-affinity purified. The reactivity by species is: (Bovine IFN gamma - None) (Canine IFN gamma - None) (Caprine IFN gamma - None) (Chicken IFN gamma - None) (Dolphin IFN gamma - Weak) (Equine IFN gamma - None) (Feline IFN gamma - None) (Ferret IFN gamma - None) (Human IFN gamma - Weak) (Mouse IFN gamma - None) (Ovine IFN gamma - None) (Rabbit IFN gamma - Strong) (Swine IFN gamma - None) (Zebrafish IFN gamma 1-1 - None) (Zebrafish IFN gamma 1-2 - None). For research use only. Made in the USA
The Rabbit IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEH LKAYLKANTS DVANGGPLFL NILRNWKEES DNKIIQSQIV SFYFKLFDNL KDHEVIKKSM ESIKEDIFVK FFNSNLTKMD DFQNLTRISV DDRLVQRKAV SELSNVLNFL SPKSNLKKRK RSQTLFRGRR ASKY (144)) (Gene ID: 100008602). For research use only. Made in the USA
Inserisci la tua e-mail e seleziona le aree di interesse per ricevere le ultime novità, approfondimenti e promozioni.
Seleziona uno o più ambiti di interesse per ricevere comunicazioni più utili e mirate.
2025 TEMA Ricerca - All Rights Reserved.
