TEMA RICERCA

Home

Descrizione	Azione
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 VIP, human, porcine, rat; VIP (28 amino acids) Codice: E-PP-2076_5mg Confezionamento: 5mg	Dettagli
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 VIP, human, porcine, rat; VIP (28 amino acids) Codice: E-PP-2076_1mg Confezionamento: 1mg	Dettagli
C163H263N47O46S2 VIP-Lys(Biotin), human, porcine, rat Codice: 5-02085 Confezionamento: 4 x 1mg	Dettagli
HSDAVFTDNYTRLRKQMAVKKYLNSILNK(Biotin) VIP-Lys(Biotin), human, porcine, rat Codice: E-PP-2081_5mg Confezionamento: 5mg	Dettagli
HSDAVFTDNYTRLRKQMAVKKYLNSILNK(Biotin) VIP-Lys(Biotin), human, porcine, rat Codice: E-PP-2081_10mg Confezionamento: 10mg	Dettagli
HSDAVFTDNYTRLRKQMAVKKYLNSILNK(Biotin) VIP-Lys(Biotin), human, porcine, rat Codice: E-PP-2081_5mg Confezionamento: 5mg	Dettagli
The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. VIP Polyclonal Antibody Codice: E-AB-70137_120μL Confezionamento: 120μL	Dettagli
The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. VIP Polyclonal Antibody Codice: E-AB-64231_60μL Confezionamento: 60μL	Dettagli
The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. VIP Polyclonal Antibody Codice: E-AB-64231_200μL Confezionamento: 200μL	Dettagli
The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. VIP Polyclonal Antibody Codice: E-AB-70137_200μL Confezionamento: 200μL	Dettagli
The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. VIP Polyclonal Antibody Codice: E-AB-64231_120μL Confezionamento: 120μL	Dettagli
The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. VIP Polyclonal Antibody Codice: E-AB-70137_60μL Confezionamento: 60μL	Dettagli

1…19999 20000 200012000220003 20004 20005…20628

Marca

Confezionamento

Conservazione

Specie target

Host

Concentrazione

Isotipo

Clonalità

Clone

Coniugazione

Detection range

Metodo di rilevazione

Tipo di campione

Tipo di saggio

Confezionamento (campo)

Data di scadenza

Applicazione

Diluizione

Sensibilità

Simbolo target

IG target

Etichetta

ID gene

Area di ricerca

Note applicative

Reset

2025 TEMA Ricerca - All Rights Reserved.