The Feline IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVLSRISSEL RCQCIKTHST PFNPKLIKEL TVIDSGPHCE NSEIIVKLVN GKEVCLDPKQ KWVQKVVEIF LKKAEKQNA) (Gene ID: 493836). For research use only. Made in the USA
The Feline LIF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline LIF applications are for cell culture, ELISA standard, and Western Blot Control. Feline LIF yeast-derived recombinant protein can be purchased in multiple sizes. Feline LIF Specifications: (Molecular Weight: 19.7 kDa) (Amino Acid Sequence: SPLPITPVNA TCATRHPCHS NLMNQIRNQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKTRL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATAD IMRGLLSNVL CRLCNKYHVA HVDVAYGPDT SGKDVFQKKK LGCQLLGKYK QVIAVVAQAF [Met139Val](180)) (Gene ID: 101090296). For research use only. Made in the USA
The Feline M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Feline M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Feline M-CSF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)) (Gene ID: 101091467). For research use only. Made in the USA
The Feline PDGF-BB yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline PDGF-BB applications are for cell culture, ELISA standard, and Western Blot Control. Feline PDGF-BB yeast-derived recombinant protein can be purchased in multiple sizes. Feline PDGF-BB Specifications: (Molecular Weight: 11.9 kDa) (Amino Acid Sequence: EAAGSPTVAE PAMIAECKTR TEVFEVSRRL IDRTNANFLV WPPCVEVQRC SGCCNNRNVQ CRPTQVQLRL VQVRKIEIVR KRPVFKKATV TLEDHLACKC ETVVA (105)) (Gene ID: 100135774). For research use only. Made in the USA
The Feline PD-L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline PD-L1 applications are for cell culture, ELISA standard, and Western Blot Control. Feline PD-L1 yeast-derived recombinant protein can be purchased in multiple sizes. Feline PD-L1 Specifications: (Molecular Weight: 24.6 kDa) (Amino Acid Sequence: FTITVSKDLY VVEYGSNVTM ECRFPVEEQL DLVSLIVYWE MEDKKIIQFV QGKEDLKVQH RSYSQRAQLL KDQLFLGKAA LQITNVTLED AGVYCCLIGY GGADYKRITL KVHAPYRKIN QRISVDPVTS EHELMCQAEG YPTAEVIWTN SAHQVLNGKT IISVSNMETK LFNVTSTLRI NTTANEIFYC TFLQRSSPEG NSTAELVIPE PFLVPANER (219)) (Gene ID: 100127110 (feline)). For research use only. Made in the USA
Inserisci la tua e-mail e seleziona le aree di interesse per ricevere le ultime novità, approfondimenti e promozioni.
Seleziona uno o più ambiti di interesse per ricevere comunicazioni più utili e mirate.
2025 TEMA Ricerca - All Rights Reserved.
