The Feline PD-L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline PD-L1 applications are for cell culture, ELISA standard, and Western Blot Control. Feline PD-L1 yeast-derived recombinant protein can be purchased in multiple sizes. Feline PD-L1 Specifications: (Molecular Weight: 24.6 kDa) (Amino Acid Sequence: FTITVSKDLY VVEYGSNVTM ECRFPVEEQL DLVSLIVYWE MEDKKIIQFV QGKEDLKVQH RSYSQRAQLL KDQLFLGKAA LQITNVTLED AGVYCCLIGY GGADYKRITL KVHAPYRKIN QRISVDPVTS EHELMCQAEG YPTAEVIWTN SAHQVLNGKT IISVSNMETK LFNVTSTLRI NTTANEIFYC TFLQRSSPEG NSTAELVIPE PFLVPANER (219)) (Gene ID: 100127110 (feline)). For research use only. Made in the USA
The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: GLCRNRVTDD VKDVTKLVAN LPKDYKIALK YVPGMDVLPS HCWISVMVEQ LSVSLTDLLD KFSNISEGLS NYSIIDKLVK IVDDLVECVE GHSSENVKKS SKSPEPRLFT PEEFFRIFNR SIDAFKDLEM VASKTSECVV SSTLSPEKDS RVSVTKPFML PPVAA (165)) (Gene ID: 493937). For research use only. Made in the USA
The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 493937). For research use only. Made in the USA
The Feline TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Feline TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Feline TNF alpha Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: LRSSSRTPSD KPVAHVVANP EAEGQLQWLS RRANALLANG VELTDNQLKV PSDGLYLIYS QVLFTGQGCP STHVLLTHTI SRFAVSYQTK VNLLSAIKSP CQRETPEGAE AKPWYEPIYL GGVFQLEKGD RLSAEINLPA YLDFAESGQV YFGIIAL (157)) (Gene ID: 493755). For research use only. Made in the USA
Inserisci la tua e-mail e seleziona le aree di interesse per ricevere le ultime novità, approfondimenti e promozioni.
Seleziona uno o più ambiti di interesse per ricevere comunicazioni più utili e mirate.
2025 TEMA Ricerca - All Rights Reserved.
