The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)) (Gene ID: 414347). For research use only. Made in the USA
The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) (Gene ID: 327712). For research use only. Made in the USA
The Bovine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSTPITCCFSVINGKIPFKKLDSYTRITNSQCPQEAVIFKTKADRDVCADPKQKWVQTSIRLLDQKSRTPKP (76)) (Gene ID: 281044). For research use only. Made in the USA
The Bovine CD27 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CD27 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CD27 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CD27 Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: TPGPKSCPEK HYWAQGGWCC QMCEPGTFLV KDCEQHREAA QCNPCTPGVS FMPDHHSRPH CESCRHCNSG LLIRNCTLTA NSECACPEGQ QCRDKDCMEC DGPAQAPGPH PQPSHLPYAE EIAESRTDRH TQTLANSRWL PAPTLSTHWS PQRSLCSANC (170)) (Gene ID: 512514). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
